Lineage for d2k7ab_ (2k7a B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1918990Protein Itk/tsk protein tyrosine kinase [82743] (1 species)
  7. 1918991Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries)
  8. 1918993Domain d2k7ab_: 2k7a B: [242394]
    Other proteins in same PDB: d2k7aa_
    automated match to d1oo4a_

Details for d2k7ab_

PDB Entry: 2k7a (more details)

PDB Description: ensemble structures of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase.
PDB Compounds: (B:) SH2 domain of Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d2k7ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k7ab_ d.93.1.1 (B:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg

SCOPe Domain Coordinates for d2k7ab_:

Click to download the PDB-style file with coordinates for d2k7ab_.
(The format of our PDB-style files is described here.)

Timeline for d2k7ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2k7aa_