Lineage for d2k7ab1 (2k7a B:232-338)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965513Protein Itk/tsk protein tyrosine kinase [82743] (1 species)
  7. 2965514Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries)
  8. 2965516Domain d2k7ab1: 2k7a B:232-338 [242394]
    Other proteins in same PDB: d2k7aa1, d2k7aa2, d2k7ab2
    automated match to d1oo4a_

Details for d2k7ab1

PDB Entry: 2k7a (more details)

PDB Description: ensemble structures of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase.
PDB Compounds: (B:) SH2 domain of Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d2k7ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k7ab1 d.93.1.1 (B:232-338) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvc

SCOPe Domain Coordinates for d2k7ab1:

Click to download the PDB-style file with coordinates for d2k7ab1.
(The format of our PDB-style files is described here.)

Timeline for d2k7ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k7ab2