SCOPe 2.06: Domain d2jsza_: 2jsz A:

Lineage for d2jsza_ (2jsz A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188752] (4 PDB entries)

8. Domain d2jsza_: 2jsz A: [242283]
   automated match to d3p7xa_

Details for d2jsza_

PDB Entry: 2jsz

PDB Description: solution structure of tpx in the reduced state

PDB Compounds: (A:) Probable thiol peroxidase

SCOPe Domain Sequences for d2jsza_:

Sequence; same for both SEQRES and ATOM records:

>d2jsza_ c.47.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
maeitfkggpvtlvgqevkvgdqapdftvltnsleeksladmkgkvtiisvipsidtgvc
daqtrrfneeaaklgdvnvytisadlpfaqarwcgangidkvetlsdhrdmsfgeafgvy
ikelrllarsvfvldengkvvyaeyvseatnhpnyekpieaakalvk

Timeline for d2jsza_:

• d2jsza_ first appeared in SCOPe 2.04
  
• d2jsza_ appears in SCOPe 2.05
  
• d2jsza_ appears in SCOPe 2.07
  
• d2jsza_ appears in the current release, SCOPe 2.08