PDB entry 2jsz

View 2jsz on RCSB PDB site
Description: Solution structure of Tpx in the reduced state
Class: Oxidoreductase
Keywords: solution structure, Antioxidant, Oxidoreductase, Peroxidase
Deposited on 2007-07-17, released 2008-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable thiol peroxidase
    Species: Bacillus subtilis
    Gene: tpx, ytgI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jsza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jszA (A:)
maeitfkggpvtlvgqevkvgdqapdftvltnsleeksladmkgkvtiisvipsidtgvc
daqtrrfneeaaklgdvnvytisadlpfaqarwcgangidkvetlsdhrdmsfgeafgvy
ikelrllarsvfvldengkvvyaeyvseatnhpnyekpieaakalvk