Lineage for d2jqta_ (2jqt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312626Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2312758Superfamily a.23.5: Hemolysin expression modulating protein HHA [68989] (2 families) (S)
    automatically mapped to Pfam PF05321
  5. 2312771Family a.23.5.0: automated matches [254243] (1 protein)
    not a true family
  6. 2312772Protein automated matches [254559] (1 species)
    not a true protein
  7. 2312773Species Escherichia coli [TaxId:562] [255288] (1 PDB entry)
  8. 2312774Domain d2jqta_: 2jqt A: [242266]
    automated match to d1jw2a_

Details for d2jqta_

PDB Entry: 2jqt (more details)

PDB Description: structure of the bacterial replication origin-associated protein cnu
PDB Compounds: (A:) H-NS/stpA-binding protein 2

SCOPe Domain Sequences for d2jqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jqta_ a.23.5.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mtvqdyllkfrkisslesleklydhlnytltddqelinmyraadhrraelvsggrlf

SCOPe Domain Coordinates for d2jqta_:

Click to download the PDB-style file with coordinates for d2jqta_.
(The format of our PDB-style files is described here.)

Timeline for d2jqta_: