Class a: All alpha proteins [46456] (290 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.5: Hemolysin expression modulating protein HHA [68989] (2 families) automatically mapped to Pfam PF05321 |
Family a.23.5.0: automated matches [254243] (1 protein) not a true family |
Protein automated matches [254559] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [255288] (1 PDB entry) |
Domain d2jqta_: 2jqt A: [242266] automated match to d1jw2a_ |
PDB Entry: 2jqt (more details)
SCOPe Domain Sequences for d2jqta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jqta_ a.23.5.0 (A:) automated matches {Escherichia coli [TaxId: 562]} mtvqdyllkfrkisslesleklydhlnytltddqelinmyraadhrraelvsggrlf
Timeline for d2jqta_: