SCOPe 2.07: Domain d2jnua1: 2jnu A:3-136

Lineage for d2jnua1 (2jnu A:3-136)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)

8. Domain d2jnua1: 2jnu A:3-136 [242249]
   Other proteins in same PDB: d2jnua2
   automated match to d2a72a_

Details for d2jnua1

PDB Entry: 2jnu

PDB Description: solution structure of the rgs domain of human rgs14

PDB Compounds: (A:) regulator of g-protein signaling 14

SCOPe Domain Sequences for d2jnua1:

Sequence; same for both SEQRES and ATOM records:

>d2jnua1 a.91.1.0 (A:3-136) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teeqpvaswalsferllqdplglayfteflkkefsaenvtfwkacerfqqipasdtqqla
qearniyqeflssqalspvnidrqawlgeevlaeprpdmfraqqlqifnlmkfdsyarfv
ksplyrecllaeae

Timeline for d2jnua1:

• d2jnua1 first appeared in SCOPe 2.04, called d2jnua_
  
• d2jnua1 appears in SCOPe 2.06
  
• d2jnua1 appears in the current release, SCOPe 2.08