Lineage for d2jnua1 (2jnu A:3-136)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004960Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2004961Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2005022Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2005023Protein automated matches [190464] (3 species)
    not a true protein
  7. 2005032Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)
  8. 2005066Domain d2jnua1: 2jnu A:3-136 [242249]
    Other proteins in same PDB: d2jnua2
    automated match to d2a72a_

Details for d2jnua1

PDB Entry: 2jnu (more details)

PDB Description: solution structure of the rgs domain of human rgs14
PDB Compounds: (A:) regulator of g-protein signaling 14

SCOPe Domain Sequences for d2jnua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jnua1 a.91.1.0 (A:3-136) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teeqpvaswalsferllqdplglayfteflkkefsaenvtfwkacerfqqipasdtqqla
qearniyqeflssqalspvnidrqawlgeevlaeprpdmfraqqlqifnlmkfdsyarfv
ksplyrecllaeae

SCOPe Domain Coordinates for d2jnua1:

Click to download the PDB-style file with coordinates for d2jnua1.
(The format of our PDB-style files is described here.)

Timeline for d2jnua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jnua2