Lineage for d2jnja1 (2jnj A:4-74)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615924Fold d.295: TFB5-like [142896] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers, a/b; antiparallel sheet, order: 132; dimerises in solution (PDB 2jnj) via extended N-terminal strand
  4. 2615925Superfamily d.295.1: TFB5-like [142897] (2 families) (S)
  5. 2615926Family d.295.1.1: TFB5-like [142898] (2 proteins)
    Pfam PF06331
  6. 2615930Protein automated matches [254556] (1 species)
    not a true protein
  7. 2615931Species Human (Homo sapiens) [TaxId:9606] [255278] (1 PDB entry)
  8. 2615932Domain d2jnja1: 2jnj A:4-74 [242246]
    Other proteins in same PDB: d2jnja2, d2jnjb2
    automated match to d1ydla1

Details for d2jnja1

PDB Entry: 2jnj (more details)

PDB Description: solution structure of the p8 tfiih subunit
PDB Compounds: (A:) TFIIH basal transcription factor complex TTD-A subunit

SCOPe Domain Sequences for d2jnja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jnja1 d.295.1.1 (A:4-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvnvlkgvliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnvlqervgel
mdqnafsltqk

SCOPe Domain Coordinates for d2jnja1:

Click to download the PDB-style file with coordinates for d2jnja1.
(The format of our PDB-style files is described here.)

Timeline for d2jnja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jnja2