Lineage for d2jnja_ (2jnj A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688549Fold d.295: TFB5-like [142896] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers, a/b; antiparallel sheet, order: 132; dimerises in solution (PDB 2jnj) via extended N-terminal strand
  4. 1688550Superfamily d.295.1: TFB5-like [142897] (2 families) (S)
  5. 1688551Family d.295.1.1: TFB5-like [142898] (2 proteins)
    Pfam PF06331
  6. 1688555Protein automated matches [254556] (1 species)
    not a true protein
  7. 1688556Species Human (Homo sapiens) [TaxId:9606] [255278] (1 PDB entry)
  8. 1688557Domain d2jnja_: 2jnj A: [242246]
    automated match to d1ydla1

Details for d2jnja_

PDB Entry: 2jnj (more details)

PDB Description: solution structure of the p8 tfiih subunit
PDB Compounds: (A:) TFIIH basal transcription factor complex TTD-A subunit

SCOPe Domain Sequences for d2jnja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jnja_ d.295.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmvnvlkgvliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnvlqerv
gelmdqnafsltqk

SCOPe Domain Coordinates for d2jnja_:

Click to download the PDB-style file with coordinates for d2jnja_.
(The format of our PDB-style files is described here.)

Timeline for d2jnja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jnjb_