Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.21: Pyrimidine 5'-nucleotidase (UMPH-1) [142183] (2 proteins) Pfam PF05822; the insertion subdomain is a rudiment 4-helical bundle |
Protein automated matches [190392] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187255] (2 PDB entries) |
Domain d2jgaa_: 2jga A: [242222] automated match to d2cn1a1 complexed with mg, po4 |
PDB Entry: 2jga (more details), 3.01 Å
SCOPe Domain Sequences for d2jgaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jgaa_ c.108.1.21 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nptrveeiicglikggaaklqiitdfdmtlsrfsykgkrcptchniidncklvtdecrrk llqlkekyyaievdpvltveekypymvewytkshgllvqqalpkaklkeivaesdvmlke gyenffdklqqhsipvfifsagigdvleevirqagvyhpnvkvvsnfmdfdetgvlkgfk gelihvfnkhdgalrnteyfnqlkdnsniillgdsqgdlrmadgvanvehilkigylndr vdellekymdsydivlvqdeslevansilqkil
Timeline for d2jgaa_: