Lineage for d2jgaa_ (2jga A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527464Family c.108.1.21: Pyrimidine 5'-nucleotidase (UMPH-1) [142183] (2 proteins)
    Pfam PF05822; the insertion subdomain is a rudiment 4-helical bundle
  6. 2527483Protein automated matches [190392] (2 species)
    not a true protein
  7. 2527484Species Human (Homo sapiens) [TaxId:9606] [187255] (2 PDB entries)
  8. 2527485Domain d2jgaa_: 2jga A: [242222]
    automated match to d2cn1a1
    complexed with mg, po4

Details for d2jgaa_

PDB Entry: 2jga (more details), 3.01 Å

PDB Description: crystal structure of human cytosolic 5'-nucleotidase iii in complex with phosphate and magnesium
PDB Compounds: (A:) Cytosolic 5'-nucleotidase III

SCOPe Domain Sequences for d2jgaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jgaa_ c.108.1.21 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nptrveeiicglikggaaklqiitdfdmtlsrfsykgkrcptchniidncklvtdecrrk
llqlkekyyaievdpvltveekypymvewytkshgllvqqalpkaklkeivaesdvmlke
gyenffdklqqhsipvfifsagigdvleevirqagvyhpnvkvvsnfmdfdetgvlkgfk
gelihvfnkhdgalrnteyfnqlkdnsniillgdsqgdlrmadgvanvehilkigylndr
vdellekymdsydivlvqdeslevansilqkil

SCOPe Domain Coordinates for d2jgaa_:

Click to download the PDB-style file with coordinates for d2jgaa_.
(The format of our PDB-style files is described here.)

Timeline for d2jgaa_: