Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein automated matches [190162] (6 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225829] (2 PDB entries) |
Domain d2is3d_: 2is3 D: [242174] automated match to d2f96a1 complexed with so4 |
PDB Entry: 2is3 (more details), 3.1 Å
SCOPe Domain Sequences for d2is3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2is3d_ c.55.3.5 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]} ltglcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfv ganlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnanfdh sfmmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalyd tertavlfceivnrwkrlggwpl
Timeline for d2is3d_: