SCOPe 2.07: Domain d2is3d_: 2is3 D:

Lineage for d2is3d_ (2is3 D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein automated matches [190162] (6 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225829] (2 PDB entries)

8. Domain d2is3d_: 2is3 D: [242174]
   automated match to d2f96a1
   complexed with so4

Details for d2is3d_

PDB Entry: 2is3, 3.1 Å

PDB Description: crystal structure of escherichia coli rnase t

PDB Compounds: (D:) Ribonuclease T

SCOPe Domain Sequences for d2is3d_:

Sequence; same for both SEQRES and ATOM records:

>d2is3d_ c.55.3.5 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ltglcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfv
ganlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnanfdh
sfmmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalyd
tertavlfceivnrwkrlggwpl

Timeline for d2is3d_:

• d2is3d_ first appeared in SCOPe 2.04
  
• d2is3d_ appears in SCOPe 2.06
  
• d2is3d_ appears in the current release, SCOPe 2.08