Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein Viral RNA polymerase [56695] (17 species) |
Species Human poliovirus 1 [TaxId:12081] [256393] (8 PDB entries) |
Domain d2ijfa_: 2ijf A: [242161] automated match to d4k4za_ mutant missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2ijf (more details), 3 Å
SCOPe Domain Sequences for d2ijfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ijfa_ e.8.1.4 (A:) Viral RNA polymerase {Human poliovirus 1 [TaxId: 12081]} geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs kyvsnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll awhngeeeynkflakirsvpigraldlpeystlydrwldsf
Timeline for d2ijfa_: