Lineage for d2ijfa_ (2ijf A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3017418Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 3017426Protein Viral RNA polymerase [56695] (17 species)
  7. 3017656Species Human poliovirus 1 [TaxId:12081] [256393] (8 PDB entries)
  8. 3017661Domain d2ijfa_: 2ijf A: [242161]
    automated match to d4k4za_
    mutant

    missing some secondary structures that made up less than one-third of the common domain

Details for d2ijfa_

PDB Entry: 2ijf (more details), 3 Å

PDB Description: crystal structure of the poliovirus rna-dependent rna polymerase fidelity mutant 3dpol g64s
PDB Compounds: (A:) RNA-directed RNA polymerase

SCOPe Domain Sequences for d2ijfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ijfa_ e.8.1.4 (A:) Viral RNA polymerase {Human poliovirus 1 [TaxId: 12081]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvsnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

SCOPe Domain Coordinates for d2ijfa_:

Click to download the PDB-style file with coordinates for d2ijfa_.
(The format of our PDB-style files is described here.)

Timeline for d2ijfa_: