SCOPe 2.04: Domain d2iema_: 2iem A:

Lineage for d2iema_ (2iem A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)

6. Protein Peptide methionine sulfoxide reductase [55070] (4 species)

7. Species Escherichia coli [TaxId:562] [55072] (2 PDB entries)

8. Domain d2iema_: 2iem A: [242113]
   automated match to d1ff3a_

Details for d2iema_

PDB Entry: 2iem

PDB Description: solution structure of an oxidized form (cys51-cys198) of e. coli methionine sulfoxide reductase a (msra)

PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrA

SCOPe Domain Sequences for d2iema_:

Sequence; same for both SEQRES and ATOM records:

>d2iema_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]}
slfdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgcfwgverlfw
qlpgvystaagytggytpnptyrevssgdtghaeavrivydpsvisyeqllqvfwenhdp
aqgmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfy
yaeddhqqylhknpygycgiggigvslppea

Timeline for d2iema_:

• d2iema_ is new in SCOPe 2.04-stable
  
• d2iema_ appears in SCOPe 2.05
  
• d2iema_ appears in the current release, SCOPe 2.08