| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) ![]() common fold is elaborated with additional secondary structures |
| Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins) |
| Protein Peptide methionine sulfoxide reductase [55070] (4 species) |
| Species Escherichia coli [TaxId:562] [55072] (2 PDB entries) |
| Domain d2iema_: 2iem A: [242113] automated match to d1ff3a_ |
PDB Entry: 2iem (more details)
SCOPe Domain Sequences for d2iema_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iema_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]}
slfdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgcfwgverlfw
qlpgvystaagytggytpnptyrevssgdtghaeavrivydpsvisyeqllqvfwenhdp
aqgmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfy
yaeddhqqylhknpygycgiggigvslppea
Timeline for d2iema_: