Lineage for d2hqra1 (2hqr A:1-117)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855988Species Helicobacter pylori [TaxId:85963] [255222] (2 PDB entries)
  8. 2855989Domain d2hqra1: 2hqr A:1-117 [242056]
    Other proteins in same PDB: d2hqra2, d2hqrb2
    automated match to d1kgsa2

Details for d2hqra1

PDB Entry: 2hqr (more details)

PDB Description: Structure of a Atypical Orphan Response Regulator Protein Revealed a New Phosphorylation-Independent Regulatory Mechanism
PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d2hqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqra1 c.23.1.0 (A:1-117) automated matches {Helicobacter pylori [TaxId: 85963]}
mrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknalsfvs
rikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlrfwg

SCOPe Domain Coordinates for d2hqra1:

Click to download the PDB-style file with coordinates for d2hqra1.
(The format of our PDB-style files is described here.)

Timeline for d2hqra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hqra2