SCOPe 2.08: Domain d2hqra2: 2hqr A:118-223

Lineage for d2hqra2 (2hqr A:118-223)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [255221] (3 PDB entries)

8. Domain d2hqra2: 2hqr A:118-223 [242057]
   Other proteins in same PDB: d2hqra1, d2hqrb1
   automated match to d1kgsa1

Details for d2hqra2

PDB Entry: 2hqr

PDB Description: Structure of a Atypical Orphan Response Regulator Protein Revealed a New Phosphorylation-Independent Regulatory Mechanism

PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d2hqra2:

Sequence; same for both SEQRES and ATOM records:

>d2hqra2 a.4.6.0 (A:118-223) automated matches {Helicobacter pylori [TaxId: 85963]}
snvieigdltispdeekiiykgrevevkgkpfevlthlarhrdqivskeqlldaiweepe
mvtpnvievainqirqkmdkplgistvetvrrrgyrfcypkpacee

Timeline for d2hqra2:

• d2hqra2 first appeared in SCOPe 2.04
  
• d2hqra2 appears in SCOPe 2.07