SCOPe 2.08: Domain d2hqrb1: 2hqr B:1-117

Lineage for d2hqrb1 (2hqr B:1-117)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [255222] (2 PDB entries)

8. Domain d2hqrb1: 2hqr B:1-117 [242058]
   Other proteins in same PDB: d2hqra2, d2hqrb2
   automated match to d1kgsa2

Details for d2hqrb1

PDB Entry: 2hqr

PDB Description: Structure of a Atypical Orphan Response Regulator Protein Revealed a New Phosphorylation-Independent Regulatory Mechanism

PDB Compounds: (B:) Putative transcriptional regulator

SCOPe Domain Sequences for d2hqrb1:

Sequence; same for both SEQRES and ATOM records:

>d2hqrb1 c.23.1.0 (B:1-117) automated matches {Helicobacter pylori [TaxId: 85963]}
mrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknalsfvs
rikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlrfwg

Timeline for d2hqrb1:

• d2hqrb1 first appeared in SCOPe 2.04
  
• d2hqrb1 appears in SCOPe 2.07