Lineage for d2h3hb_ (2h3h B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624744Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1624745Protein automated matches [190646] (49 species)
    not a true protein
  7. 1624926Species Thermotoga maritima [TaxId:2336] [255200] (2 PDB entries)
  8. 1624927Domain d2h3hb_: 2h3h B: [242000]
    automated match to d2fn8a_
    complexed with bgc

Details for d2h3hb_

PDB Entry: 2h3h (more details), 1.7 Å

PDB Description: crystal structure of the liganded form of thermotoga maritima glucose binding protein
PDB Compounds: (B:) Sugar ABC transporter, periplasmic sugar-binding protein

SCOPe Domain Sequences for d2h3hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3hb_ c.93.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
mltigvigksvhpywsqveqgvkaagkalgvdtkffvpqkedinaqlqmlesfiaegvng
iaiapsdptaviptikkalemgipvvtldtdspdsgryvyigtdnyqagytaglimkell
ggkgkvvigtgsltamnslqriqgfkdaikdseieivdilndeedgaravslaeaalnah
pdldaffgvyayngpaqalvvknagkvgkvkivcfdttpdilqyvkegviqatmgqrpym
mgylsvtvlylmnkigvqntlmmlpkvkvdgkvdyvidtgvdvvtpenldeylkkmeelg
ipikf

SCOPe Domain Coordinates for d2h3hb_:

Click to download the PDB-style file with coordinates for d2h3hb_.
(The format of our PDB-style files is described here.)

Timeline for d2h3hb_: