SCOPe 2.06: Domain d2gvsa_: 2gvs A:

Lineage for d2gvsa_ (2gvs A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.21: Chemosensory protein Csp2 [100910] (2 families)
   automatically mapped to Pfam PF03392

5. Family a.118.21.0: automated matches [254235] (1 protein)
   not a true family

6. Protein automated matches [254535] (1 species)
   not a true protein

7. Species Desert locust (Schistocerca gregaria) [TaxId:7010] [255195] (1 PDB entry)

8. Domain d2gvsa_: 2gvs A: [241988]
   automated match to d1k19a_

Details for d2gvsa_

PDB Entry: 2gvs

PDB Description: nmr solution structure of cspsg4

PDB Compounds: (A:) chemosensory protein CSP-sg4

SCOPe Domain Sequences for d2gvsa_:

Sequence; same for both SEQRES and ATOM records:

>d2gvsa_ a.118.21.0 (A:) automated matches {Desert locust (Schistocerca gregaria) [TaxId: 7010]}
eekyttkydnvnldeilandrllnkyvqclleddesnctadgkelksvipdalsnecakc
nekqkegtkkvlkhlinhkpdvwaqlkakydpdgtyskkyedrekelhq

Timeline for d2gvsa_:

• d2gvsa_ first appeared in SCOPe 2.04
  
• d2gvsa_ appears in SCOPe 2.05
  
• d2gvsa_ appears in SCOPe 2.07
  
• d2gvsa_ appears in the current release, SCOPe 2.08