Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.21: Chemosensory protein Csp2 [100910] (2 families) automatically mapped to Pfam PF03392 |
Family a.118.21.0: automated matches [254235] (1 protein) not a true family |
Protein automated matches [254535] (1 species) not a true protein |
Species Desert locust (Schistocerca gregaria) [TaxId:7010] [255195] (1 PDB entry) |
Domain d2gvsa_: 2gvs A: [241988] automated match to d1k19a_ |
PDB Entry: 2gvs (more details)
SCOPe Domain Sequences for d2gvsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvsa_ a.118.21.0 (A:) automated matches {Desert locust (Schistocerca gregaria) [TaxId: 7010]} eekyttkydnvnldeilandrllnkyvqclleddesnctadgkelksvipdalsnecakc nekqkegtkkvlkhlinhkpdvwaqlkakydpdgtyskkyedrekelhq
Timeline for d2gvsa_: