Lineage for d2gvsa_ (2gvs A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1502010Superfamily a.118.21: Chemosensory protein Csp2 [100910] (2 families) (S)
    automatically mapped to Pfam PF03392
  5. 1502024Family a.118.21.0: automated matches [254235] (1 protein)
    not a true family
  6. 1502025Protein automated matches [254535] (1 species)
    not a true protein
  7. 1502026Species Desert locust (Schistocerca gregaria) [TaxId:7010] [255195] (1 PDB entry)
  8. 1502027Domain d2gvsa_: 2gvs A: [241988]
    automated match to d1k19a_

Details for d2gvsa_

PDB Entry: 2gvs (more details)

PDB Description: nmr solution structure of cspsg4
PDB Compounds: (A:) chemosensory protein CSP-sg4

SCOPe Domain Sequences for d2gvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvsa_ a.118.21.0 (A:) automated matches {Desert locust (Schistocerca gregaria) [TaxId: 7010]}
eekyttkydnvnldeilandrllnkyvqclleddesnctadgkelksvipdalsnecakc
nekqkegtkkvlkhlinhkpdvwaqlkakydpdgtyskkyedrekelhq

SCOPe Domain Coordinates for d2gvsa_:

Click to download the PDB-style file with coordinates for d2gvsa_.
(The format of our PDB-style files is described here.)

Timeline for d2gvsa_: