| Class a: All alpha proteins [46456] (285 folds) |
Superfamily a.118.21: Chemosensory protein Csp2 [100910] (2 families) ![]() automatically mapped to Pfam PF03392 |
| Family a.118.21.0: automated matches [254235] (1 protein) not a true family |
| Protein automated matches [254535] (1 species) not a true protein |
| Species Desert locust (Schistocerca gregaria) [TaxId:7010] [255195] (1 PDB entry) |
| Domain d2gvsa_: 2gvs A: [241988] automated match to d1k19a_ |
PDB Entry: 2gvs (more details)
SCOPe Domain Sequences for d2gvsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvsa_ a.118.21.0 (A:) automated matches {Desert locust (Schistocerca gregaria) [TaxId: 7010]}
eekyttkydnvnldeilandrllnkyvqclleddesnctadgkelksvipdalsnecakc
nekqkegtkkvlkhlinhkpdvwaqlkakydpdgtyskkyedrekelhq
Timeline for d2gvsa_: