SCOPe 2.08: Domain d2gvpa1: 2gvp A:132-301

Lineage for d2gvpa1 (2gvp A:132-301)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d2gvpa1: 2gvp A:132-301 [241987]
   Other proteins in same PDB: d2gvpa2
   automated match to d2b7ja1

Details for d2gvpa1

PDB Entry: 2gvp

PDB Description: solution structure of human apo sco1

PDB Compounds: (A:) SCO1 protein homolog, mitochondrial

SCOPe Domain Sequences for d2gvpa1:

Sequence; same for both SEQRES and ATOM records:

>d2gvpa1 c.47.1.0 (A:132-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkpllggpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsit
tlpdltplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkd
ededyivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyrkks

Timeline for d2gvpa1:

• d2gvpa1 first appeared in SCOPe 2.04, called d2gvpa_
  
• d2gvpa1 appears in SCOPe 2.07