Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (62 PDB entries) |
Domain d2graa1: 2gra A:1-164 [241963] Other proteins in same PDB: d2graa2, d2graa3, d2grab2, d2grab3, d2grac2, d2grac3, d2grad2, d2grad3, d2grae2, d2grae3 automated match to d2izzb1 complexed with glu, nap |
PDB Entry: 2gra (more details), 3.1 Å
SCOPe Domain Sequences for d2graa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2graa1 c.2.1.0 (A:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee
Timeline for d2graa1: