Lineage for d2graa1 (2gra A:1-164)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847291Domain d2graa1: 2gra A:1-164 [241963]
    Other proteins in same PDB: d2graa2, d2graa3, d2grab2, d2grab3, d2grac2, d2grac3, d2grad2, d2grad3, d2grae2, d2grae3
    automated match to d2izzb1
    complexed with glu, nap

Details for d2graa1

PDB Entry: 2gra (more details), 3.1 Å

PDB Description: crystal structure of Human Pyrroline-5-carboxylate Reductase complexed with nadp
PDB Compounds: (A:) Pyrroline-5-carboxylate reductase 1

SCOPe Domain Sequences for d2graa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2graa1 c.2.1.0 (A:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv
qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc
mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee

SCOPe Domain Coordinates for d2graa1:

Click to download the PDB-style file with coordinates for d2graa1.
(The format of our PDB-style files is described here.)

Timeline for d2graa1: