Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (22 species) not a true protein |
Species Escherichia coli [TaxId:562] [255192] (4 PDB entries) |
Domain d2gq0a_: 2gq0 A: [241947] automated match to d3pryc_ |
PDB Entry: 2gq0 (more details), 1.9 Å
SCOPe Domain Sequences for d2gq0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gq0a_ d.14.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} aqalwtrnkseitdeeykefykhiahdfndpltwshnrvegkqeytsllyipsqapwdmw nrdhkhglklyvqrvfimddaeqfmpnylrfvrglidssdlplnvsreilqdstvtrnlr naltkrvlqmleklakddaekyqtfwqqfglvlkegpaedfanqeaiakllrfasthtds saqtvsledyvsrmkegqekiyyitadsyaaakssphlellrkkgievlllsdridewmm nyltefdgkpfqsvsk
Timeline for d2gq0a_: