Lineage for d2gq0a_ (2gq0 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2538081Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2538082Protein automated matches [190826] (22 species)
    not a true protein
  7. 2538161Species Escherichia coli [TaxId:562] [255192] (4 PDB entries)
  8. 2538163Domain d2gq0a_: 2gq0 A: [241947]
    automated match to d3pryc_

Details for d2gq0a_

PDB Entry: 2gq0 (more details), 1.9 Å

PDB Description: crystal structure of the middle domain of htpg, the e. coli hsp90
PDB Compounds: (A:) Chaperone protein htpG

SCOPe Domain Sequences for d2gq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gq0a_ d.14.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
aqalwtrnkseitdeeykefykhiahdfndpltwshnrvegkqeytsllyipsqapwdmw
nrdhkhglklyvqrvfimddaeqfmpnylrfvrglidssdlplnvsreilqdstvtrnlr
naltkrvlqmleklakddaekyqtfwqqfglvlkegpaedfanqeaiakllrfasthtds
saqtvsledyvsrmkegqekiyyitadsyaaakssphlellrkkgievlllsdridewmm
nyltefdgkpfqsvsk

SCOPe Domain Coordinates for d2gq0a_:

Click to download the PDB-style file with coordinates for d2gq0a_.
(The format of our PDB-style files is described here.)

Timeline for d2gq0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gq0b_