SCOPe 2.06: Domain d2gq0a_: 2gq0 A:

Lineage for d2gq0a_ (2gq0 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (17 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255192] (4 PDB entries)

8. Domain d2gq0a_: 2gq0 A: [241947]
   automated match to d3pryc_

Details for d2gq0a_

PDB Entry: 2gq0, 1.9 Å

PDB Description: crystal structure of the middle domain of htpg, the e. coli hsp90

PDB Compounds: (A:) Chaperone protein htpG

SCOPe Domain Sequences for d2gq0a_:

Sequence; same for both SEQRES and ATOM records:

>d2gq0a_ d.14.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
aqalwtrnkseitdeeykefykhiahdfndpltwshnrvegkqeytsllyipsqapwdmw
nrdhkhglklyvqrvfimddaeqfmpnylrfvrglidssdlplnvsreilqdstvtrnlr
naltkrvlqmleklakddaekyqtfwqqfglvlkegpaedfanqeaiakllrfasthtds
saqtvsledyvsrmkegqekiyyitadsyaaakssphlellrkkgievlllsdridewmm
nyltefdgkpfqsvsk

Timeline for d2gq0a_:

• d2gq0a_ first appeared in SCOPe 2.04
  
• d2gq0a_ appears in SCOPe 2.05
  
• d2gq0a_ appears in SCOPe 2.07
  
• d2gq0a_ appears in the current release, SCOPe 2.08