SCOPe 2.07: Domain d2fn5a1: 2fn5 A:4-94

Lineage for d2fn5a1 (2fn5 A:4-94)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (10 PDB entries)

8. Domain d2fn5a1: 2fn5 A:4-94 [241868]
   Other proteins in same PDB: d2fn5a2
   automated match to d1wf8a1

Details for d2fn5a1

PDB Entry: 2fn5

PDB Description: nmr structure of the neurabin pdz domain (502-594)

PDB Compounds: (A:) Neurabin-1

SCOPe Domain Sequences for d2fn5a1:

Sequence; same for both SEQRES and ATOM records:

>d2fn5a1 b.36.1.1 (A:4-94) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
elfpvelekdedglgisiigmgvgadagleklgifvktvteggaaqrdgriqvndqivev
dgislvgvtqnfaatvlrntkgnvrfvigre

Timeline for d2fn5a1:

• d2fn5a1 first appeared in SCOPe 2.04, called d2fn5a_
  
• d2fn5a1 appears in SCOPe 2.06
  
• d2fn5a1 appears in the current release, SCOPe 2.08