Lineage for d2fc9a1 (2fc9 A:8-95)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2559336Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2559337Protein automated matches [190896] (11 species)
    not a true protein
  7. 2559375Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)
  8. 2559510Domain d2fc9a1: 2fc9 A:8-95 [241828]
    Other proteins in same PDB: d2fc9a2, d2fc9a3
    automated match to d3mdfa_

Details for d2fc9a1

PDB Entry: 2fc9 (more details)

PDB Description: solution structure of the rrm_1 domain of ncl protein
PDB Compounds: (A:) NCL protein

SCOPe Domain Sequences for d2fc9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fc9a1 d.58.7.0 (A:8-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nstwsgesktlvlsnlsysateetlqevfekatfikvpqnqngkskgyafiefasfedak
ealnscnkreiegrairlelqgprgspn

SCOPe Domain Coordinates for d2fc9a1:

Click to download the PDB-style file with coordinates for d2fc9a1.
(The format of our PDB-style files is described here.)

Timeline for d2fc9a1: