SCOPe 2.07: Domain d2fc9a1: 2fc9 A:8-95

Lineage for d2fc9a1 (2fc9 A:8-95)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)

8. Domain d2fc9a1: 2fc9 A:8-95 [241828]
   Other proteins in same PDB: d2fc9a2, d2fc9a3
   automated match to d3mdfa_

Details for d2fc9a1

PDB Entry: 2fc9

PDB Description: solution structure of the rrm_1 domain of ncl protein

PDB Compounds: (A:) NCL protein

SCOPe Domain Sequences for d2fc9a1:

Sequence; same for both SEQRES and ATOM records:

>d2fc9a1 d.58.7.0 (A:8-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nstwsgesktlvlsnlsysateetlqevfekatfikvpqnqngkskgyafiefasfedak
ealnscnkreiegrairlelqgprgspn

Timeline for d2fc9a1:

• d2fc9a1 first appeared in SCOPe 2.04, called d2fc9a_
  
• d2fc9a1 appears in SCOPe 2.06
  
• d2fc9a1 appears in the current release, SCOPe 2.08