Lineage for d2f2da1 (2f2d A:35-153)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941753Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)
  8. 2941786Domain d2f2da1: 2f2d A:35-153 [241804]
    Other proteins in same PDB: d2f2da2
    automated match to d3ey6a_

Details for d2f2da1

PDB Entry: 2f2d (more details)

PDB Description: solution structure of the fk506-binding domain of human fkbp38
PDB Compounds: (A:) 38 kDa FK-506 binding protein homolog, FKBP38

SCOPe Domain Sequences for d2f2da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2da1 d.26.1.0 (A:35-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepelvftlgdcd
viqaldlsvplmdvgetamvtadskycygpqgrspyipphaalclevtlktavdgpdle

SCOPe Domain Coordinates for d2f2da1:

Click to download the PDB-style file with coordinates for d2f2da1.
(The format of our PDB-style files is described here.)

Timeline for d2f2da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f2da2