Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225017] (9 PDB entries) |
Domain d2f2da_: 2f2d A: [241804] automated match to d3ey6a_ |
PDB Entry: 2f2d (more details)
SCOPe Domain Sequences for d2f2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2da_ d.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mrewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepelvftlgd cdviqaldlsvplmdvgetamvtadskycygpqgrspyipphaalclevtlktavdgpdl e
Timeline for d2f2da_: