SCOPe 2.04: Domain d2f2da_: 2f2d A:

Lineage for d2f2da_ (2f2d A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (9 PDB entries)

8. Domain d2f2da_: 2f2d A: [241804]
   automated match to d3ey6a_

Details for d2f2da_

PDB Entry: 2f2d

PDB Description: solution structure of the fk506-binding domain of human fkbp38

PDB Compounds: (A:) 38 kDa FK-506 binding protein homolog, FKBP38

SCOPe Domain Sequences for d2f2da_:

Sequence; same for both SEQRES and ATOM records:

>d2f2da_ d.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepelvftlgd
cdviqaldlsvplmdvgetamvtadskycygpqgrspyipphaalclevtlktavdgpdl
e

Timeline for d2f2da_:

• d2f2da_ is new in SCOPe 2.04-stable
  
• d2f2da_ appears in SCOPe 2.05
  
• d2f2da_ appears in the current release, SCOPe 2.08, called d2f2da1