![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
![]() | Protein automated matches [191063] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254969] (13 PDB entries) |
![]() | Domain d2ew9a2: 2ew9 A:75-149 [241798] Other proteins in same PDB: d2ew9a3 automated match to d1kvja_ |
PDB Entry: 2ew9 (more details)
SCOPe Domain Sequences for d2ew9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ew9a2 d.58.17.0 (A:75-149) automated matches {Human (Homo sapiens) [TaxId: 9606]} yagsdgnieltitgmtcascvhnieskltrtngityasvalatskalvkfdpeiigprdi ikiieeigfhaslaq
Timeline for d2ew9a2: