Lineage for d1kvja_ (1kvj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2953869Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2953958Protein Menkes copper-transporting ATPase [55012] (1 species)
  7. 2953959Species Human (Homo sapiens) [TaxId:9606] [55013] (7 PDB entries)
  8. 2953965Domain d1kvja_: 1kvj A: [91043]
    1st metal-binding domain
    complexed with cu1

Details for d1kvja_

PDB Entry: 1kvj (more details)

PDB Description: solution structure of the cu(i) bound form of the first heavy metal binding motif of the menkes protein
PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1kvja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}
mdpsmgvnsvtisvegmtcnscvwtieqqigkvngvhhikvsleeknatiiydpklqtpk
tlqeaiddmgfdavihnpd

SCOPe Domain Coordinates for d1kvja_:

Click to download the PDB-style file with coordinates for d1kvja_.
(The format of our PDB-style files is described here.)

Timeline for d1kvja_: