Lineage for d1cpm__ (1cpm -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57850Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins)
  6. 57851Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species)
  7. 57854Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries)
  8. 57860Domain d1cpm__: 1cpm - [24178]

Details for d1cpm__

PDB Entry: 1cpm (more details), 2 Å

PDB Description: native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis

SCOP Domain Sequences for d1cpm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpm__ b.29.1.2 (-) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans}
fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
immnlwngtgvddwlgsynganplyaeydwvkytsnqtggsffepfnsynsgtwekadgy
snggvfnctwrannvnftndgklklgltssayna

SCOP Domain Coordinates for d1cpm__:

Click to download the PDB-style file with coordinates for d1cpm__.
(The format of our PDB-style files is described here.)

Timeline for d1cpm__: