Lineage for d1cpm__ (1cpm -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins) 
Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species) 
Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries) 
Domain d1cpm__: 1cpm - [24178]
Details for d1cpm__
PDB Entry: 1cpm (more details), 2 Å
PDB Description: native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis
SCOP Domain Sequences for d1cpm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpm__ b.29.1.2 (-) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans}
fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
immnlwngtgvddwlgsynganplyaeydwvkytsnqtggsffepfnsynsgtwekadgy
snggvfnctwrannvnftndgklklgltssayna
SCOP Domain Coordinates for d1cpm__:
Click to download the PDB-style file with coordinates for d1cpm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cpm__:
- d1cpm__ appears in SCOP 1.57
- d1cpm__ appears in the current release, SCOPe 2.08, called d1cpma_
View in 3D