Lineage for d1cpma_ (1cpm A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373777Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 protein domains)
    Pfam PF00722
    beta-Glucanase-like
  6. 2373778Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 2373781Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries)
  8. 2373791Domain d1cpma_: 1cpm A: [24178]
    circularly permuted
    complexed with ca

Details for d1cpma_

PDB Entry: 1cpm (more details), 2 Å

PDB Description: native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis
PDB Compounds: (A:) circularly permuted

SCOPe Domain Sequences for d1cpma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpma_ b.29.1.2 (A:) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans [TaxId: 44252]}
fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
immnlwngtgvddwlgsynganplyaeydwvkytsnqtggsffepfnsynsgtwekadgy
snggvfnctwrannvnftndgklklgltssayna

SCOPe Domain Coordinates for d1cpma_:

Click to download the PDB-style file with coordinates for d1cpma_.
(The format of our PDB-style files is described here.)

Timeline for d1cpma_: