Lineage for d1glh__ (1glh -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226869Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins)
  6. 226870Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species)
  7. 226884Species Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans [49928] (3 PDB entries)
  8. 226886Domain d1glh__: 1glh - [24173]
    complexed with na

Details for d1glh__

PDB Entry: 1glh (more details), 2.2 Å

PDB Description: cation binding to a bacillus (1,3-1,4)-beta-glucanase. geometry, affinity and effect on protein stability

SCOP Domain Sequences for d1glh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glh__ b.29.1.2 (-) Bacillus 1-3,1-4-beta-glucanase {Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans}
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn

SCOP Domain Coordinates for d1glh__:

Click to download the PDB-style file with coordinates for d1glh__.
(The format of our PDB-style files is described here.)

Timeline for d1glh__: