Lineage for d2ayh__ (2ayh -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 108803Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins)
  6. 108804Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species)
  7. 108818Species Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans [49928] (3 PDB entries)
  8. 108819Domain d2ayh__: 2ayh - [24172]

Details for d2ayh__

PDB Entry: 2ayh (more details), 1.6 Å

PDB Description: crystal and molecular structure at 1.6 angstroms resolution of the hybrid bacillus endo-1,3-1,4-beta-d-glucan 4-glucanohydrolase h(a16-m)

SCOP Domain Sequences for d2ayh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayh__ b.29.1.2 (-) Bacillus 1-3,1-4-beta-glucanase {Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans}
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn

SCOP Domain Coordinates for d2ayh__:

Click to download the PDB-style file with coordinates for d2ayh__.
(The format of our PDB-style files is described here.)

Timeline for d2ayh__: