Lineage for d2ayha_ (2ayh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779081Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2779082Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 2779108Species synthetic, hybrid between Bacillus amyloliquefaciens and Bacillus macerans proteins [49928] (3 PDB entries)
  8. 2779109Domain d2ayha_: 2ayh A: [24172]
    complexed with ca

Details for d2ayha_

PDB Entry: 2ayh (more details), 1.6 Å

PDB Description: crystal and molecular structure at 1.6 angstroms resolution of the hybrid bacillus endo-1,3-1,4-beta-d-glucan 4-glucanohydrolase h(a16-m)
PDB Compounds: (A:) 1,3-1,4-beta-d-glucan 4-glucanohydrolase

SCOPe Domain Sequences for d2ayha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayha_ b.29.1.2 (A:) Bacillus 1-3,1-4-beta-glucanase {synthetic, hybrid between Bacillus amyloliquefaciens and Bacillus macerans proteins}
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn

SCOPe Domain Coordinates for d2ayha_:

Click to download the PDB-style file with coordinates for d2ayha_.
(The format of our PDB-style files is described here.)

Timeline for d2ayha_: