Lineage for d1gbg__ (1gbg -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226869Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins)
  6. 226870Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species)
  7. 226871Species Bacillus licheniformis [TaxId:1402] [49927] (1 PDB entry)
  8. 226872Domain d1gbg__: 1gbg - [24171]
    complexed with ca

Details for d1gbg__

PDB Entry: 1gbg (more details), 1.8 Å

PDB Description: bacillus licheniformis beta-glucanase

SCOP Domain Sequences for d1gbg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbg__ b.29.1.2 (-) Bacillus 1-3,1-4-beta-glucanase {Bacillus licheniformis}
qtggsfyepfnnyntglwqkadgysngnmfnctwrannvsmtslgemrlsltspsynkfd
cgenrsvqtygyglyevnmkpaknvgivssfftytgptdgtpwdeidieflgkdttkvqf
nyytngvgnhekivnlgfdaansyhtyafdwqpnsikwyvdgqlkhtattqipqtpgkim
mnlwngagvdewlgsyngvtplyahynwvrytkr

SCOP Domain Coordinates for d1gbg__:

Click to download the PDB-style file with coordinates for d1gbg__.
(The format of our PDB-style files is described here.)

Timeline for d1gbg__: