SCOPe 2.08: Domain d2e73a1: 2e73 A:36-105

Lineage for d2e73a1 (2e73 A:36-105)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (4 families)

5. Family g.49.1.0: automated matches [254207] (1 protein)
   not a true family

6. Protein automated matches [254456] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255130] (3 PDB entries)

8. Domain d2e73a1: 2e73 A:36-105 [241697]
   Other proteins in same PDB: d2e73a2
   automated match to d4fkda_
   complexed with zn

Details for d2e73a1

PDB Entry: 2e73

PDB Description: solution structure of the phorbol esters/diacylglycerol binding domain of protein kinase c gamma

PDB Compounds: (A:) protein kinase c gamma type

SCOPe Domain Sequences for d2e73a1:

Sequence; same for both SEQRES and ATOM records:

>d2e73a1 g.49.1.0 (A:36-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hkftarffkqptfcshctdfiwgigkqglqcqvcsfvvhrrchefvtfecpgagkgpqtd
dprnkhkfrl

Timeline for d2e73a1:

• d2e73a1 first appeared in SCOPe 2.04, called d2e73a_
  
• d2e73a1 appears in SCOPe 2.07