![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) ![]() |
![]() | Family g.49.1.0: automated matches [254207] (1 protein) not a true family |
![]() | Protein automated matches [254456] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255130] (3 PDB entries) |
![]() | Domain d2e73a1: 2e73 A:36-105 [241697] Other proteins in same PDB: d2e73a2 automated match to d4fkda_ complexed with zn |
PDB Entry: 2e73 (more details)
SCOPe Domain Sequences for d2e73a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e73a1 g.49.1.0 (A:36-105) automated matches {Human (Homo sapiens) [TaxId: 9606]} hkftarffkqptfcshctdfiwgigkqglqcqvcsfvvhrrchefvtfecpgagkgpqtd dprnkhkfrl
Timeline for d2e73a1: