Lineage for d2e73a1 (2e73 A:36-105)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588840Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588841Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2588893Family g.49.1.0: automated matches [254207] (1 protein)
    not a true family
  6. 2588894Protein automated matches [254456] (2 species)
    not a true protein
  7. 2588895Species Human (Homo sapiens) [TaxId:9606] [255130] (3 PDB entries)
  8. 2588897Domain d2e73a1: 2e73 A:36-105 [241697]
    Other proteins in same PDB: d2e73a2
    automated match to d4fkda_
    complexed with zn

Details for d2e73a1

PDB Entry: 2e73 (more details)

PDB Description: Solution structure of the phorbol esters/diacylglycerol binding domain of protein kinase C gamma
PDB Compounds: (A:) protein kinase c gamma type

SCOPe Domain Sequences for d2e73a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e73a1 g.49.1.0 (A:36-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hkftarffkqptfcshctdfiwgigkqglqcqvcsfvvhrrchefvtfecpgagkgpqtd
dprnkhkfrl

SCOPe Domain Coordinates for d2e73a1:

Click to download the PDB-style file with coordinates for d2e73a1.
(The format of our PDB-style files is described here.)

Timeline for d2e73a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e73a2