PDB entry 2e73

View 2e73 on RCSB PDB site
Description: Solution structure of the phorbol esters/diacylglycerol binding domain of protein kinase C gamma
Class: transferase
Keywords: C1 domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2007-01-05, released 2007-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein kinase c gamma type
  Species: Homo sapiens [TaxId:9606]
  Gene: PRKCG, PKCG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05129 (7-76)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d2e73a1, d2e73a2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2e73A (A:)
  gssgssghkftarffkqptfcshctdfiwgigkqglqcqvcsfvvhrrchefvtfecpga
  gkgpqtddprnkhkfrl