Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
Protein P100 co-activator, SND1 [141207] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141208] (3 PDB entries) Uniprot Q7KZF4 705-794 |
Domain d2e6na1: 2e6n A:8-104 [241694] Other proteins in same PDB: d2e6na2 automated match to d2o4xb_ has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2e6n (more details)
SCOPe Domain Sequences for d2e6na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e6na1 b.34.9.1 (A:8-104) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} gtqleklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfy idygnrevlpstrlgtlspafstrvlpaqateyafaf
Timeline for d2e6na1: