Lineage for d2e6na1 (2e6n A:8-104)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784546Protein P100 co-activator, SND1 [141207] (1 species)
  7. 2784547Species Human (Homo sapiens) [TaxId:9606] [141208] (3 PDB entries)
    Uniprot Q7KZF4 705-794
  8. 2784551Domain d2e6na1: 2e6n A:8-104 [241694]
    Other proteins in same PDB: d2e6na2
    automated match to d2o4xb_
    has additional insertions and/or extensions that are not grouped together

Details for d2e6na1

PDB Entry: 2e6n (more details)

PDB Description: solution structure of the tudor domain of staphylococcal nuclease domain-containing protein 1
PDB Compounds: (A:) Staphylococcal nuclease domain-containing protein 1

SCOPe Domain Sequences for d2e6na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e6na1 b.34.9.1 (A:8-104) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]}
gtqleklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfy
idygnrevlpstrlgtlspafstrvlpaqateyafaf

SCOPe Domain Coordinates for d2e6na1:

Click to download the PDB-style file with coordinates for d2e6na1.
(The format of our PDB-style files is described here.)

Timeline for d2e6na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e6na2