Lineage for d2o4xb_ (2o4x B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784675Protein automated matches [190752] (1 species)
    not a true protein
  7. 2784676Species Human (Homo sapiens) [TaxId:9606] [187947] (8 PDB entries)
  8. 2784678Domain d2o4xb_: 2o4x B: [166549]
    automated match to d2hqxa1

Details for d2o4xb_

PDB Entry: 2o4x (more details), 2 Å

PDB Description: Crystal structure of human P100 tudor domain
PDB Compounds: (B:) Staphylococcal nuclease domain-containing protein 1

SCOPe Domain Sequences for d2o4xb_:

Sequence, based on SEQRES records: (download)

>d2o4xb_ b.34.9.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqfeklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi
dygnrevlpstrlgtlspafstrvlpaqate

Sequence, based on observed residues (ATOM records): (download)

>d2o4xb_ b.34.9.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqfeklmenmrndiashppyaprrgefciakfvdgewyrarvekvespakihvfyidygn
revlpstrlgtlspafstrvlpaqate

SCOPe Domain Coordinates for d2o4xb_:

Click to download the PDB-style file with coordinates for d2o4xb_.
(The format of our PDB-style files is described here.)

Timeline for d2o4xb_: