PDB entry 2e6n

View 2e6n on RCSB PDB site
Description: Solution structure of the TUDOR domain of Staphylococcal nuclease domain-containing protein 1
Class: transcription
Keywords: NMR, YUDOR domain, Staphylococcal nuclease domain-containing protein 1, p100 co-activator, 100 kDa coactivator, EBNA2 coactivator p100, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-12-27, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Staphylococcal nuclease domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SND1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KZF4 (7-103)
      • cloning artifact (0-6)
    Domains in SCOPe 2.08: d2e6na1, d2e6na2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e6nA (A:)
    gssgssggtqleklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvesp
    akihvfyidygnrevlpstrlgtlspafstrvlpaqateyafaf