SCOPe 2.08: Domain d2dzda1: 2dzd A:3-120

Lineage for d2dzda1 (2dzd A:3-120)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Geobacillus thermodenitrificans [TaxId:33940] [255125] (1 PDB entry)

8. Domain d2dzda1: 2dzd A:3-120 [241665]
   Other proteins in same PDB: d2dzda2, d2dzda3, d2dzdb2, d2dzdb3
   automated match to d1ulza2

Details for d2dzda1

PDB Entry: 2dzd, 2.4 Å

PDB Description: crystal structure of the biotin carboxylase domain of pyruvate carboxylase

PDB Compounds: (A:) pyruvate carboxylase

SCOPe Domain Sequences for d2dzda1:

Sequence; same for both SEQRES and ATOM records:

>d2dzda1 c.30.1.0 (A:3-120) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
trrirkvlvanrgeiairvfractelgirtvaiyskedvgsyhrykadeaylvgegkkpi
eayldiegiieiakahdvdaihpgygflseniqfakrcreegiifigpnenhldmfgd

Timeline for d2dzda1:

• d2dzda1 first appeared in SCOPe 2.04
  
• d2dzda1 appears in SCOPe 2.07