Lineage for d2dzda1 (2dzd A:3-120)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862421Species Geobacillus thermodenitrificans [TaxId:33940] [255125] (1 PDB entry)
  8. 2862422Domain d2dzda1: 2dzd A:3-120 [241665]
    Other proteins in same PDB: d2dzda2, d2dzda3, d2dzdb2, d2dzdb3
    automated match to d1ulza2

Details for d2dzda1

PDB Entry: 2dzd (more details), 2.4 Å

PDB Description: crystal structure of the biotin carboxylase domain of pyruvate carboxylase
PDB Compounds: (A:) pyruvate carboxylase

SCOPe Domain Sequences for d2dzda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dzda1 c.30.1.0 (A:3-120) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
trrirkvlvanrgeiairvfractelgirtvaiyskedvgsyhrykadeaylvgegkkpi
eayldiegiieiakahdvdaihpgygflseniqfakrcreegiifigpnenhldmfgd

SCOPe Domain Coordinates for d2dzda1:

Click to download the PDB-style file with coordinates for d2dzda1.
(The format of our PDB-style files is described here.)

Timeline for d2dzda1: