SCOPe 2.08: Domain d2dzda3: 2dzd A:340-461

Lineage for d2dzda3 (2dzd A:340-461)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (16 species)
   not a true protein

7. Species Geobacillus thermodenitrificans [TaxId:33940] [255127] (1 PDB entry)

8. Domain d2dzda3: 2dzd A:340-461 [241667]
   Other proteins in same PDB: d2dzda1, d2dzda2, d2dzdb1, d2dzdb2
   automated match to d1ulza1

Details for d2dzda3

PDB Entry: 2dzd, 2.4 Å

PDB Description: crystal structure of the biotin carboxylase domain of pyruvate carboxylase

PDB Compounds: (A:) pyruvate carboxylase

SCOPe Domain Sequences for d2dzda3:

Sequence; same for both SEQRES and ATOM records:

>d2dzda3 b.84.2.0 (A:340-461) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
ingyaiqsrvttedplnnfmpdtgkimayrsgggfgvrldagngfqgavitpyydsllvk
lstwaltfeqaarkmlrnlrefrirgiktnipflenvvqhpkflsgeydtsfidttpelf
vf

Timeline for d2dzda3:

• d2dzda3 first appeared in SCOPe 2.04
  
• d2dzda3 appears in SCOPe 2.07