Lineage for d2dzdb3 (2dzd B:340-461)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817665Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2817666Protein automated matches [254496] (16 species)
    not a true protein
  7. 2817692Species Geobacillus thermodenitrificans [TaxId:33940] [255127] (1 PDB entry)
  8. 2817694Domain d2dzdb3: 2dzd B:340-461 [241670]
    Other proteins in same PDB: d2dzda1, d2dzda2, d2dzdb1, d2dzdb2
    automated match to d1ulza1

Details for d2dzdb3

PDB Entry: 2dzd (more details), 2.4 Å

PDB Description: crystal structure of the biotin carboxylase domain of pyruvate carboxylase
PDB Compounds: (B:) pyruvate carboxylase

SCOPe Domain Sequences for d2dzdb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dzdb3 b.84.2.0 (B:340-461) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
ingyaiqsrvttedplnnfmpdtgkimayrsgggfgvrldagngfqgavitpyydsllvk
lstwaltfeqaarkmlrnlrefrirgiktnipflenvvqhpkflsgeydtsfidttpelf
vf

SCOPe Domain Coordinates for d2dzdb3:

Click to download the PDB-style file with coordinates for d2dzdb3.
(The format of our PDB-style files is described here.)

Timeline for d2dzdb3: