Lineage for d1fatb_ (1fat B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226529Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 226853Protein Phytohemagglutinin-L, PHA-L, also arcelin [49920] (2 species)
    single-chain subunit has "generic" topology
  7. 226854Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49921] (4 PDB entries)
  8. 226863Domain d1fatb_: 1fat B: [24165]

Details for d1fatb_

PDB Entry: 1fat (more details), 2.8 Å

PDB Description: phytohemagglutinin-l

SCOP Domain Sequences for d1fatb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fatb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris)}
sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn
ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva
vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy
psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls

SCOP Domain Coordinates for d1fatb_:

Click to download the PDB-style file with coordinates for d1fatb_.
(The format of our PDB-style files is described here.)

Timeline for d1fatb_: