| Class b: All beta proteins [48724] (178 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.0: automated matches [191593] (1 protein) not a true family |
| Protein automated matches [191080] (7 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255119] (2 PDB entries) |
| Domain d2dnca1: 2dnc A:8-92 [241622] Other proteins in same PDB: d2dnca2, d2dnca3 automated match to d2q8ib_ |
PDB Entry: 2dnc (more details)
SCOPe Domain Sequences for d2dnca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dnca1 b.84.1.0 (A:8-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikilmpslsptmeegnivkwlkkegeavsagdalceietdkavvtldasddgilakivve
egsknirlgsligliveegedwkhv
Timeline for d2dnca1: