SCOPe 2.07: Domain d2dnca1: 2dnc A:8-92

Lineage for d2dnca1 (2dnc A:8-92)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.0: automated matches [191593] (1 protein)
   not a true family

6. Protein automated matches [191080] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255119] (2 PDB entries)

8. Domain d2dnca1: 2dnc A:8-92 [241622]
   Other proteins in same PDB: d2dnca2, d2dnca3
   automated match to d2q8ib_

Details for d2dnca1

PDB Entry: 2dnc

PDB Description: solution structure of rsgi ruh-054, a lipoyl domain from human 2- oxoacid dehydrogenase

PDB Compounds: (A:) Pyruvate dehydrogenase protein X component

SCOPe Domain Sequences for d2dnca1:

Sequence; same for both SEQRES and ATOM records:

>d2dnca1 b.84.1.0 (A:8-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikilmpslsptmeegnivkwlkkegeavsagdalceietdkavvtldasddgilakivve
egsknirlgsligliveegedwkhv

Timeline for d2dnca1:

• d2dnca1 first appeared in SCOPe 2.04, called d2dnca_
  
• d2dnca1 appears in SCOPe 2.06
  
• d2dnca1 appears in the current release, SCOPe 2.08