PDB entry 2dnc

View 2dnc on RCSB PDB site
Description: Solution Structure of RSGI RUH-054, a lipoyl domain from human 2-oxoacid dehydrogenase
Class: transferase
Keywords: Lipoic Acid, Lipoyl domain, 2-oxoacid dehydrogenase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2006-04-25, released 2006-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pyruvate dehydrogenase protein X component
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00330 (7-91)
    • cloning artifact (0-6)
    • cloning artifact (92-97)
  Domains in SCOPe 2.07: d2dnca1, d2dnca2, d2dnca3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dncA (A:)
  gssgssgikilmpslsptmeegnivkwlkkegeavsagdalceietdkavvtldasddgi
  lakivveegsknirlgsligliveegedwkhvsgpssg